PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G45610.1
Common NameDOF3.2, DOF6, F9K21.190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 245aa    MW: 26958 Da    PI: 9.1147
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G45610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-383697263
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                 +e++l+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG lrn+P+Gg+ rk+k+sss
  AT3G45610.1 36 PEQSLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSS 97
                 67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-303694IPR003851Zinc finger, Dof-type
PfamPF027016.4E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4074094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDYSSMHQNV MGVSSCSTQD YQNQKKPLSA TRPAPPEQSL RCPRCDSTNT KFCYYNNYSL  60
SQPRYFCKSC RRYWTKGGIL RNIPIGGAYR KHKRSSSATK SLRTTPEPTM THDGKSFPTA  120
SFGYNNNNIS NEQMELGLAY ALLNKQPLGV SSHLGFGSSQ SPMAMDGVYG TTSHQMENTG  180
YAFGNGGGGM EQMATSDPNR VLWGFPWQMN MGGGSGHGHG HVDQIDSGRE IWSSTVNYIN  240
TGALL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.4780.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306926170.0
Genevisible252586_at0.0
Expression AtlasAT3G45610-
AtGenExpressAT3G45610-
ATTED-IIAT3G45610-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. DOF6 negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of ABA-related genes.
    [PMID: 22155632]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00392DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G45610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G47620
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G45610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0627830.0AY062783.1 Arabidopsis thaliana dof6 zinc finger protein (F9K21.19) mRNA, complete cds.
GenBankBT0062840.0BT006284.1 Arabidopsis thaliana At3g45610 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190147.10.0Dof zinc finger protein DOF3.2
SwissprotQ9M1E60.0DOF32_ARATH; Dof zinc finger protein DOF3.2
TrEMBLR0HL641e-155R0HL64_9BRAS; Uncharacterized protein
STRINGAT3G45610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  6. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  7. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  8. Rueda-Romero P,Barrero-Sicilia C,G
    Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.
    J. Exp. Bot., 2012. 63(5): p. 1937-49
    [PMID:22155632]